(data stored in ACNUC10821 zone)

EMBL: AE017262.PE311

AE017262.PE311       Location/Qualifiers
FT   CDS             335465..335944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0314"
FT                   /product="conserved hypothetical protein TIGR00246"
FT                   /note="identified by similarity to OMNI:NTL01LI0319; match
FT                   to protein family HMM PF02590; match to protein family HMM
FT                   TIGR00246"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0314"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03101"
FT                   /db_xref="GOA:Q724B0"
FT                   /db_xref="InterPro:IPR003742"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q724B0"
FT                   /protein_id="AAT03101.1"
FT                   /translation="MNIQIVTVGKLKEKYLVQGIAEYLKRLSAYAKVTIVEVPDEKAPE
FT                   VLSDAEMKQVKDKEGARILAKIPDDAHVIALAIDGKMKSSEEFAADLDKLATYGKSKVT
FT                   FVIGGSLGLSEAVLKRSNERISFGRLTLPHQLMRLVLVEQVYRAFRIVRGEPYHK"
     MNIQIVTVGK LKEKYLVQGI AEYLKRLSAY AKVTIVEVPD EKAPEVLSDA EMKQVKDKEG        60
     ARILAKIPDD AHVIALAIDG KMKSSEEFAA DLDKLATYGK SKVTFVIGGS LGLSEAVLKR       120
     SNERISFGRL TLPHQLMRLV LVEQVYRAFR IVRGEPYHK                              159
//

If you have problems or comments...

PBIL Back to PBIL home page