(data stored in ACNUC10821 zone)

EMBL: AE017262.PE313

AE017262.PE313       Location/Qualifiers
FT   CDS             336958..337695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0316"
FT                   /product="nitroreductase family protein"
FT                   /note="identified by match to protein family HMM PF00881"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0316"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03103"
FT                   /protein_id="AAT03103.1"
FT                   /translation="MNTTIQQLVKHVSVREFKNERLSDEIKQHLLTAARSASSSHFVQS
FT                   FSILEITDEKLRKELAEITNSASYVNQTGTFYVFVGDLYRQSKLLLENNRTLDGLRNME
FT                   SLLVSVIDATIAAQNMVIAAESLDLGICYIGGIRNDIEKVGELLNLPPFTIPVFGLTVG
FT                   IPEYKNQVKPRLLLENQVGENQYPHEQFTDLKAYEELTKDYYALREKNQHQTSWGDKNV
FT                   AFFEEIRRPEIAGFLKKQGFTLD"
     MNTTIQQLVK HVSVREFKNE RLSDEIKQHL LTAARSASSS HFVQSFSILE ITDEKLRKEL        60
     AEITNSASYV NQTGTFYVFV GDLYRQSKLL LENNRTLDGL RNMESLLVSV IDATIAAQNM       120
     VIAAESLDLG ICYIGGIRND IEKVGELLNL PPFTIPVFGL TVGIPEYKNQ VKPRLLLENQ       180
     VGENQYPHEQ FTDLKAYEEL TKDYYALREK NQHQTSWGDK NVAFFEEIRR PEIAGFLKKQ       240
     GFTLD                                                                   245
//

If you have problems or comments...

PBIL Back to PBIL home page