(data stored in ACNUC10821 zone)

EMBL: AE017262.PE314

AE017262.PE314       Location/Qualifiers
FT   CDS             337906..338544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0317"
FT                   /product="putative membrane protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0322"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0317"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03104"
FT                   /protein_id="AAT03104.1"
FT                   /translation="MKFLKKYGFYFLLLGVLSDFLTPYILGIFYPELNQMTRVMSVFGD
FT                   VASPVRGAFLVWSVVSGVFFVLALPAIYQSVVKTSRTLAILLASAIGLYGIGDCIFTGL
FT                   FSIDTEQASWTFSTWVHNIGSGLGYAGFLIFPLFLVILYRKTGDKTRSNIYLVLLIVSL
FT                   LSAGVYGLARIPAVNDLPVLDKIGFCQRISFFFNYLPIVVFGIDRIRKP"
     MKFLKKYGFY FLLLGVLSDF LTPYILGIFY PELNQMTRVM SVFGDVASPV RGAFLVWSVV        60
     SGVFFVLALP AIYQSVVKTS RTLAILLASA IGLYGIGDCI FTGLFSIDTE QASWTFSTWV       120
     HNIGSGLGYA GFLIFPLFLV ILYRKTGDKT RSNIYLVLLI VSLLSAGVYG LARIPAVNDL       180
     PVLDKIGFCQ RISFFFNYLP IVVFGIDRIR KP                                     212
//

If you have problems or comments...

PBIL Back to PBIL home page