(data stored in ACNUC10821 zone)

EMBL: AE017262.PE315

AE017262.PE315       Location/Qualifiers
FT   CDS             complement(338549..340420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0318"
FT                   /product="PRD/PTS system IIA 2 domain protein"
FT                   /note="identified by match to protein family HMM PF00359;
FT                   match to protein family HMM PF00874"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0318"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03105"
FT                   /protein_id="AAT03105.1"
FT                   /translation="MTISERQRSLLEKLNDSQKTVTAKALSEMLGVSSKTVRNDIVQIN
FT                   QSFSSTIIASKAGKGYFLTPNEQLSQINLTKNSENLHFELLRHIIEQDHTNFYDLADQF
FT                   FISESTLARIIKELNAVIAEKDESLCIIRKNNELLTEGGEEEKRRIFNLFLNQEIENHQ
FT                   LSLDKYADYFDYCNLKQLSELIIAYHKKNDFFMNDFSTISFILHIAVLIERISMGSYIQ
FT                   RTALTEQDKTSLEMAEHLAETLENELQINIPTQELSYIARLYSGKLTTTSTIDAQVFGS
FT                   VVTRLLEAVDQNFHIDFSADEKIATYLVAHISALYKRANHKQYLTNPLTEELKNKFPFI
FT                   YNVSVYASAFIQKELAITFPDDEIAYIALHFLSASETINHGKKRKILLVSPYGAGSQRL
FT                   IHNQLKKIADFSIDLLVSQSIFDIKQFTLDKEIHLIITAEPLNLTTDIPVYHYDLLLTE
FT                   TDLQKIKHILETKPKADSISRKFFKKELFFPKQNFKSKEEVITFLCEQLTAFDYCDSDY
FT                   VSKVFEREQLSSTCYGNYYAIPHAIQRSAKKNAVAVCALDKPIDWGGNRVKLVLLLTMK
FT                   EERDNSFEELFGQLVTILNERSFVKKLAKQEDFQQFIELCEQKTLDS"
     MTISERQRSL LEKLNDSQKT VTAKALSEML GVSSKTVRND IVQINQSFSS TIIASKAGKG        60
     YFLTPNEQLS QINLTKNSEN LHFELLRHII EQDHTNFYDL ADQFFISEST LARIIKELNA       120
     VIAEKDESLC IIRKNNELLT EGGEEEKRRI FNLFLNQEIE NHQLSLDKYA DYFDYCNLKQ       180
     LSELIIAYHK KNDFFMNDFS TISFILHIAV LIERISMGSY IQRTALTEQD KTSLEMAEHL       240
     AETLENELQI NIPTQELSYI ARLYSGKLTT TSTIDAQVFG SVVTRLLEAV DQNFHIDFSA       300
     DEKIATYLVA HISALYKRAN HKQYLTNPLT EELKNKFPFI YNVSVYASAF IQKELAITFP       360
     DDEIAYIALH FLSASETINH GKKRKILLVS PYGAGSQRLI HNQLKKIADF SIDLLVSQSI       420
     FDIKQFTLDK EIHLIITAEP LNLTTDIPVY HYDLLLTETD LQKIKHILET KPKADSISRK       480
     FFKKELFFPK QNFKSKEEVI TFLCEQLTAF DYCDSDYVSK VFEREQLSST CYGNYYAIPH       540
     AIQRSAKKNA VAVCALDKPI DWGGNRVKLV LLLTMKEERD NSFEELFGQL VTILNERSFV       600
     KKLAKQEDFQ QFIELCEQKT LDS                                               623
//

If you have problems or comments...

PBIL Back to PBIL home page