(data stored in ACNUC10821 zone)

EMBL: AE017262.PE317

AE017262.PE317       Location/Qualifiers
FT   CDS             complement(341837..342127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0320"
FT                   /product="PTS system, cellobiose-specific, IIB component"
FT                   /note="identified by match to protein family HMM PF02302"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0320"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03107"
FT                   /protein_id="AAT03107.1"
FT                   /translation="MKNIMLVCNAGMSTGMLAKKIEAASGNTLNVTAYSESEYTDYLDG
FT                   VDLVLIGPQIRFLMPQIKQAVSVPVHAISPVKYGIMDGKGVYEDIQKLIGG"
     MKNIMLVCNA GMSTGMLAKK IEAASGNTLN VTAYSESEYT DYLDGVDLVL IGPQIRFLMP        60
     QIKQAVSVPV HAISPVKYGI MDGKGVYEDI QKLIGG                                  96
//

If you have problems or comments...

PBIL Back to PBIL home page