(data stored in ACNUC10821 zone)

EMBL: AE017262.PE322

AE017262.PE322       Location/Qualifiers
FT   CDS             346304..346510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0326"
FT                   /product="DNA-binding protein"
FT                   /note="identified by match to protein family HMM PF01381"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0326"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03112"
FT                   /protein_id="AAT03112.1"
FT                   /translation="MIRLRINEILKEREMSQKALCELSGLRPTTVSEMCRGVRTTVNLQ
FT                   HLETLIDALEIEDFNQILKRDKV"
     MIRLRINEIL KEREMSQKAL CELSGLRPTT VSEMCRGVRT TVNLQHLETL IDALEIEDFN        60
     QILKRDKV                                                                 68
//

If you have problems or comments...

PBIL Back to PBIL home page