(data stored in ACNUC10821 zone)

EMBL: AE017262.PE323

AE017262.PE323       Location/Qualifiers
FT   CDS             346513..347922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0327"
FT                   /product="C-5 cytosine-specific DNA methylase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00145;
FT                   match to protein family HMM TIGR00675"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0327"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03113"
FT                   /protein_id="AAT03113.1"
FT                   /translation="MSLNIFSMFDGVGGFIVGLNDANEAIEKEMFRTTYSNQFEPSKKA
FT                   QDAYEVGLYRFPEMNHIPDDIMTVSDNKFQEMHDAGVNMIVGGFPCQDYSVARSLKDEQ
FT                   GIAGKKGVLFWEIIRAINKIQPKYLILENVDRLLKSPSTQRGRDFAIMLGAFNKLGYSV
FT                   EWRVINAAEYGRAQRRRRVFFFVYRNDTKWAKKIDEKYENEKLEEGLLEDVVIASNQYD
FT                   DYIFQEGLFARQFPIENKIKYDGKRPRHASHFLGKDADYDDYILNISDNFTGTVWNTGI
FT                   MRHGRYFTADTTPIEEPPISLGTIVEKAKQSFISQYDNLDLGIKEYNSYIEQYVISDEI
FT                   KIEKFKTLRGSKKIPRKRPDGSEYFYAEGAMSPYDSFDLPARTMLTSEASVNRSTHLLF
FT                   ENNKYRLITPIEAELLQDFPINWTKYKMNEETNEVSEVSDRMRYFFMGNALVTGIVKRI
FT                   GIELAKIESHE"
     MSLNIFSMFD GVGGFIVGLN DANEAIEKEM FRTTYSNQFE PSKKAQDAYE VGLYRFPEMN        60
     HIPDDIMTVS DNKFQEMHDA GVNMIVGGFP CQDYSVARSL KDEQGIAGKK GVLFWEIIRA       120
     INKIQPKYLI LENVDRLLKS PSTQRGRDFA IMLGAFNKLG YSVEWRVINA AEYGRAQRRR       180
     RVFFFVYRND TKWAKKIDEK YENEKLEEGL LEDVVIASNQ YDDYIFQEGL FARQFPIENK       240
     IKYDGKRPRH ASHFLGKDAD YDDYILNISD NFTGTVWNTG IMRHGRYFTA DTTPIEEPPI       300
     SLGTIVEKAK QSFISQYDNL DLGIKEYNSY IEQYVISDEI KIEKFKTLRG SKKIPRKRPD       360
     GSEYFYAEGA MSPYDSFDLP ARTMLTSEAS VNRSTHLLFE NNKYRLITPI EAELLQDFPI       420
     NWTKYKMNEE TNEVSEVSDR MRYFFMGNAL VTGIVKRIGI ELAKIESHE                   469
//

If you have problems or comments...

PBIL Back to PBIL home page