(data stored in ACNUC10821 zone)

EMBL: AE017262.PE324

AE017262.PE324       Location/Qualifiers
FT   CDS             348172..349026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0328"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0328"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03114"
FT                   /protein_id="AAT03114.1"
FT                   /translation="MYNFRVISANEDIFIKTKYRFISELEDFKEFAQTLTDDAGKAKVK
FT                   SGKASSYTRYLIRLIIFYCETHRDNLEELSSFEAVKKLEKIRLDESFKAFNQESNRFYS
FT                   ATLSCYLAYVTFKNSDAEEIMDNQIISTLNNFENPAQVVKENKSTYLVRVPKSRASKRK
FT                   NNNVYSYPRNYVEAIEARRRCGWVCEFNQEHKTFINIKDGKPYVEGHHLIPMAVQDYYD
FT                   NTIDFADNIICLCPTCHRKIHYAVQSEKKEMLIKIFNEREKFYLQHGIEIDRKTLLSFY
FT                   GIF"
     MYNFRVISAN EDIFIKTKYR FISELEDFKE FAQTLTDDAG KAKVKSGKAS SYTRYLIRLI        60
     IFYCETHRDN LEELSSFEAV KKLEKIRLDE SFKAFNQESN RFYSATLSCY LAYVTFKNSD       120
     AEEIMDNQII STLNNFENPA QVVKENKSTY LVRVPKSRAS KRKNNNVYSY PRNYVEAIEA       180
     RRRCGWVCEF NQEHKTFINI KDGKPYVEGH HLIPMAVQDY YDNTIDFADN IICLCPTCHR       240
     KIHYAVQSEK KEMLIKIFNE REKFYLQHGI EIDRKTLLSF YGIF                        284
//

If you have problems or comments...

PBIL Back to PBIL home page