(data stored in ACNUC10821 zone)

EMBL: AE017262.PE327

AE017262.PE327       Location/Qualifiers
FT   CDS             351321..352241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0331"
FT                   /product="peptidase, M48 family"
FT                   /note="identified by match to protein family HMM PF01435"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0331"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03117"
FT                   /protein_id="AAT03117.1"
FT                   /translation="MEIRKSKFNYVYIIWTTLTVLIALMIVKKILAIPLLGAITIISAL
FT                   FVGVFVLNYGLFGDWRNRVRLGLKKPATLNEVNGLNSINEEVFQKVSSFYPKVKKAEVF
FT                   VIAENDINAYALGQKTIGITKGALASLNIGELKAVIAHEYGHLANKDTLNFILLNTSFT
FT                   ILSIALLPIYGISFFIGFVFAFVEGMLSGNSSISTSLLSVVTKIVGWSYLKYYELGFYF
FT                   VNLGSRDFEYRADEVAAKAGYGEELLSFFYLLEKTDGDVRKGLLAFLASTHPYTSYRIQ
FT                   NIEKFIGISDSVNEIEYQNYSKLID"
     MEIRKSKFNY VYIIWTTLTV LIALMIVKKI LAIPLLGAIT IISALFVGVF VLNYGLFGDW        60
     RNRVRLGLKK PATLNEVNGL NSINEEVFQK VSSFYPKVKK AEVFVIAEND INAYALGQKT       120
     IGITKGALAS LNIGELKAVI AHEYGHLANK DTLNFILLNT SFTILSIALL PIYGISFFIG       180
     FVFAFVEGML SGNSSISTSL LSVVTKIVGW SYLKYYELGF YFVNLGSRDF EYRADEVAAK       240
     AGYGEELLSF FYLLEKTDGD VRKGLLAFLA STHPYTSYRI QNIEKFIGIS DSVNEIEYQN       300
     YSKLID                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page