(data stored in ACNUC10821 zone)

EMBL: AE017262.PE336

AE017262.PE336       Location/Qualifiers
FT   CDS             360401..360793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0340"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0345; match
FT                   to protein family HMM PF08000"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0340"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03126"
FT                   /protein_id="AAT03126.1"
FT                   /translation="MLDKLLGKAAVVTESSYGIERFLGEDETIIQIFKFVRDEVIITSK
FT                   GIFNVDAQGITGKKVEYKFFPKKALKYVSIETAGTLDRDFDLKIGVDGNTVVTQNTSFS
FT                   APISLKVHKNDTEMGFALYKMIKEML"
     MLDKLLGKAA VVTESSYGIE RFLGEDETII QIFKFVRDEV IITSKGIFNV DAQGITGKKV        60
     EYKFFPKKAL KYVSIETAGT LDRDFDLKIG VDGNTVVTQN TSFSAPISLK VHKNDTEMGF       120
     ALYKMIKEML                                                              130
//

If you have problems or comments...

PBIL Back to PBIL home page