(data stored in ACNUC10821 zone)

EMBL: AE017262.PE337

AE017262.PE337       Location/Qualifiers
FT   CDS             complement(360828..361601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0341"
FT                   /product="endonuclease/exonuclease/phosphatase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF03372"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0341"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03127"
FT                   /protein_id="AAT03127.1"
FT                   /translation="MFSVTTFNIRFDDTSERKKSWELRKTLTKSLLDKYQWDFMGVEEP
FT                   LLPQMRDMKEMQDWDYFGVGRDDGFEKGEFTAVFYNSTRFTLLQEGHFWLSETPEVPSI
FT                   HSTAMFPRICVWGKLEDSTDGKQFYIFNTHLDHISEEARLFASQLLLHKASLIQEDLPV
FT                   ILLGDFNTEPSTPTYNLITQRYQDAQLLSKTPVKGPLGSFHDFQPLRPESELEKIDYIF
FT                   VSNEFHICSYETSTDEIDGCSASDHFPVMAVVGWT"
     MFSVTTFNIR FDDTSERKKS WELRKTLTKS LLDKYQWDFM GVEEPLLPQM RDMKEMQDWD        60
     YFGVGRDDGF EKGEFTAVFY NSTRFTLLQE GHFWLSETPE VPSIHSTAMF PRICVWGKLE       120
     DSTDGKQFYI FNTHLDHISE EARLFASQLL LHKASLIQED LPVILLGDFN TEPSTPTYNL       180
     ITQRYQDAQL LSKTPVKGPL GSFHDFQPLR PESELEKIDY IFVSNEFHIC SYETSTDEID       240
     GCSASDHFPV MAVVGWT                                                      257
//

If you have problems or comments...

PBIL Back to PBIL home page