(data stored in ACNUC10821 zone)

EMBL: AE017262.PE339

AE017262.PE339       Location/Qualifiers
FT   CDS             362491..363393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0343"
FT                   /product="putative transcriptional activator"
FT                   /note="identified by match to protein family HMM PF01381;
FT                   match to protein family HMM TIGR01716"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0343"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03129"
FT                   /protein_id="AAT03129.1"
FT                   /translation="MGSYGELIREIRLSKGLTQKEVYTGIISRSYAIGFEKGKHEITLS
FT                   LFEEILKRIMVPLDEFFFIYRDFSSTEDDSFWIDFVELSGKNDVVGMQALLDKITLERT
FT                   EQTEVRKAILHTRIQTINHYLRTNVFDESNISDEYKKIIHDYLWKMQTWTLEEVRIFSN
FT                   GISFFEEEVQIHFYQIMLKSYEKYRYYDRGRLLFCHLFANLTDELIIQNKINYANLVLE
FT                   KLKEASETSGSFNSAFYRIVANYYQGAIWMKEGEVEKGYRQAKRAIQTWKELHYEAIAD
FT                   LYSVVLKQFLEKENIQVED"
     MGSYGELIRE IRLSKGLTQK EVYTGIISRS YAIGFEKGKH EITLSLFEEI LKRIMVPLDE        60
     FFFIYRDFSS TEDDSFWIDF VELSGKNDVV GMQALLDKIT LERTEQTEVR KAILHTRIQT       120
     INHYLRTNVF DESNISDEYK KIIHDYLWKM QTWTLEEVRI FSNGISFFEE EVQIHFYQIM       180
     LKSYEKYRYY DRGRLLFCHL FANLTDELII QNKINYANLV LEKLKEASET SGSFNSAFYR       240
     IVANYYQGAI WMKEGEVEKG YRQAKRAIQT WKELHYEAIA DLYSVVLKQF LEKENIQVED       300
//

If you have problems or comments...

PBIL Back to PBIL home page