(data stored in ACNUC10821 zone)

EMBL: AE017262.PE34

AE017262.PE34        Location/Qualifiers
FT   CDS             complement(36872..37636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0036"
FT                   /product="putative membrane protein"
FT                   /note="identified by similarity to SP:P37491"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0036"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02824"
FT                   /protein_id="AAT02824.1"
FT                   /translation="MKNQFTYLINNKTTQGMFILILFIPCIEIVQLYIMLKPDAVNIHP
FT                   AFAFFLAGSSRGHITQILLLWFLPVLSLLLGADSPIQEYQTGVRNIIINKIGKKAYILQ
FT                   KLAVSFILCFITMLTTLLLNFILVSIVFLGGTYKMGLNGLGSLNTLFDFSIQNPYLADF
FT                   GFGFMACLMAGMAGLIATSSSLFFLNKKFAYPAAFFIWFLMILPNNSIMFIFQPFTEYG
FT                   FEIILPIFLVFSLIVLIIVGVLYLYEVKYVKE"
     MKNQFTYLIN NKTTQGMFIL ILFIPCIEIV QLYIMLKPDA VNIHPAFAFF LAGSSRGHIT        60
     QILLLWFLPV LSLLLGADSP IQEYQTGVRN IIINKIGKKA YILQKLAVSF ILCFITMLTT       120
     LLLNFILVSI VFLGGTYKMG LNGLGSLNTL FDFSIQNPYL ADFGFGFMAC LMAGMAGLIA       180
     TSSSLFFLNK KFAYPAAFFI WFLMILPNNS IMFIFQPFTE YGFEIILPIF LVFSLIVLII       240
     VGVLYLYEVK YVKE                                                         254
//

If you have problems or comments...

PBIL Back to PBIL home page