(data stored in ACNUC10821 zone)

EMBL: AE017262.PE340

AE017262.PE340       Location/Qualifiers
FT   CDS             363557..364429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0344"
FT                   /product="putative transcriptional activator"
FT                   /note="identified by match to protein family HMM PF01381;
FT                   match to protein family HMM TIGR01716"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0344"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03130"
FT                   /protein_id="AAT03130.1"
FT                   /translation="MISYGELIRQIRQSKKISQKEVYTGVISKSYAIEFEKGTHAISSL
FT                   LLEKIVAKLMVSMEEFFLMYHQEELPEKEDFWETYARTCKTDEASAWESLYQKISLEKG
FT                   KVNQVKSAAIKLELDHIKGKQVADKKAVQILENYLIEAVFWTLQDIFLFTRMMHYLPLK
FT                   SRVPFYYKLLNTLDRYRHFERGRSILQSALASIMDDFIERNEIEHMELMIKSLEKISED
FT                   CDGTYFKILCMYYRGIVRWGEGEEREGGEEIEQAVAILRALGYENKAIEYETMYRQFAR
FT                   ENNDIKTME"
     MISYGELIRQ IRQSKKISQK EVYTGVISKS YAIEFEKGTH AISSLLLEKI VAKLMVSMEE        60
     FFLMYHQEEL PEKEDFWETY ARTCKTDEAS AWESLYQKIS LEKGKVNQVK SAAIKLELDH       120
     IKGKQVADKK AVQILENYLI EAVFWTLQDI FLFTRMMHYL PLKSRVPFYY KLLNTLDRYR       180
     HFERGRSILQ SALASIMDDF IERNEIEHME LMIKSLEKIS EDCDGTYFKI LCMYYRGIVR       240
     WGEGEEREGG EEIEQAVAIL RALGYENKAI EYETMYRQFA RENNDIKTME                  290
//

If you have problems or comments...

PBIL Back to PBIL home page