(data stored in ACNUC10821 zone)

EMBL: AE017262.PE341

AE017262.PE341       Location/Qualifiers
FT   CDS             364736..368677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0345"
FT                   /product="leucine rich repeat domain/ LPXTG-motif cell wall
FT                   anchor domain protein"
FT                   /note="identified by similarity to OMNI:NTL01LM2386; match
FT                   to protein family HMM PF00746; match to protein family HMM
FT                   PF06458; match to protein family HMM TIGR01167"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0345"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03131"
FT                   /protein_id="AAT03131.1"
FT                   /translation="MNSNEPFIKEIEKETGKTRANITQTDLEAITALRVTGASDIPTNI
FT                   DMLTHLTTLEVKNGTLSSVSNSVGNLKELKILVLNDNNLSTFPMIAFQLPKLEELQVSG
FT                   GTIEEIPATITNMASHLKFLGILNNHLVKVPDAIFTTNWTNATGGDLDLMAAGNQIVTN
FT                   IPANYISQFNNGDNLLEFYDNNYQKQDQLTTTPGYTIDVPVGTDFNQLTPDKTKLALTS
FT                   GRTLLAQHEFEYYDDGSSSLIHNGVAAAPGQATIFIKSKFSTQSNKFARTQVTVNITAL
FT                   NGGPITVKHEDTKGQELAPPVILNGKDGDPYTTTQKTFPGYTLVATPANQNGTFTMNPA
FT                   TVNYVYSANDYKLTSTFKDAQGQELKAPVVDTKDYHIQDNYTTTAATIPGYSLVATPAN
FT                   QNGTFGAGNVTVNYVYKKDDYTLTSTYKDTNGQELKAPVVDATTYHYQDTYTTTAAVFP
FT                   GYTLVATPTNATGTFGSSNITVHYVYQANGYQLTSTFKDQQGKTIAPDDVDTKTYHVND
FT                   PYTTTAKTIPGYTLVTTPTNNQGNFGTSDITVDYVYKAEDYTLTSTYKDAQGKELKQPV
FT                   VDSKKYHIQDNYSTSAATIPGYTLVATPANETGTFHTSDVTVNYVYKLTDLKLTSTYKD
FT                   AQGTELKPPVVDSKTYHIQDNYATTAAVIPGYTLVATPANQSGTFGSTDIQVNYVYQAV
FT                   AYKLTSTYKDQQGNDLALPKVDSKTYHIQDGYTTSDIAIPGYTLVAAPTNQTGTFGASD
FT                   VTVNYVYKANDYTLTSTYKDAQGKELKTPVIDSQKYHIRDTYTTTGATIPGYTLVAAPA
FT                   NQSGTFGAANVTVNYVYKADDYTLTSTYKDANGKELKAPVVDSKTYHTKDNYSTSAATI
FT                   PGYTLVAAPTNQTGTFNTSNVTVNYVYKANEYTLTSTFKNVQGTELKPAIVKKGFIIKD
FT                   GYATSGVTIPGYTLVATPSNKKGTFGASNVTVNYVYKANGYALITTYKDTQGKDLKPLA
FT                   IDTKTYNINDPYTATALNISGYTLTTTPANEKGVFGASDETVNYVYKANDYTLTTTYKD
FT                   ANGKELQAPKVDAKTYHIQDTYKTTAAIIPGYTLVATPKNDQGTFGASNVTVNYVYQTN
FT                   DYTLTSTFKDAQGNELKAAEVDAQKYHIHDTYTSKAAVIPGYSLEKTPTNETGTFNASD
FT                   IQVNYVYKANDYQLTSTFKDQQGNEIALPTVDAKTYHIHDAYTTKAHLIPGYSLVAAPK
FT                   NQIGAFGTSDVTVNYVYKKDAIIKPITPAKPTILTIKTPESKVVKTKVVKQTLPKTGDD
FT                   DAGLLNLLRLIGLVLILGVFLAVGSKKLR"
     MNSNEPFIKE IEKETGKTRA NITQTDLEAI TALRVTGASD IPTNIDMLTH LTTLEVKNGT        60
     LSSVSNSVGN LKELKILVLN DNNLSTFPMI AFQLPKLEEL QVSGGTIEEI PATITNMASH       120
     LKFLGILNNH LVKVPDAIFT TNWTNATGGD LDLMAAGNQI VTNIPANYIS QFNNGDNLLE       180
     FYDNNYQKQD QLTTTPGYTI DVPVGTDFNQ LTPDKTKLAL TSGRTLLAQH EFEYYDDGSS       240
     SLIHNGVAAA PGQATIFIKS KFSTQSNKFA RTQVTVNITA LNGGPITVKH EDTKGQELAP       300
     PVILNGKDGD PYTTTQKTFP GYTLVATPAN QNGTFTMNPA TVNYVYSAND YKLTSTFKDA       360
     QGQELKAPVV DTKDYHIQDN YTTTAATIPG YSLVATPANQ NGTFGAGNVT VNYVYKKDDY       420
     TLTSTYKDTN GQELKAPVVD ATTYHYQDTY TTTAAVFPGY TLVATPTNAT GTFGSSNITV       480
     HYVYQANGYQ LTSTFKDQQG KTIAPDDVDT KTYHVNDPYT TTAKTIPGYT LVTTPTNNQG       540
     NFGTSDITVD YVYKAEDYTL TSTYKDAQGK ELKQPVVDSK KYHIQDNYST SAATIPGYTL       600
     VATPANETGT FHTSDVTVNY VYKLTDLKLT STYKDAQGTE LKPPVVDSKT YHIQDNYATT       660
     AAVIPGYTLV ATPANQSGTF GSTDIQVNYV YQAVAYKLTS TYKDQQGNDL ALPKVDSKTY       720
     HIQDGYTTSD IAIPGYTLVA APTNQTGTFG ASDVTVNYVY KANDYTLTST YKDAQGKELK       780
     TPVIDSQKYH IRDTYTTTGA TIPGYTLVAA PANQSGTFGA ANVTVNYVYK ADDYTLTSTY       840
     KDANGKELKA PVVDSKTYHT KDNYSTSAAT IPGYTLVAAP TNQTGTFNTS NVTVNYVYKA       900
     NEYTLTSTFK NVQGTELKPA IVKKGFIIKD GYATSGVTIP GYTLVATPSN KKGTFGASNV       960
     TVNYVYKANG YALITTYKDT QGKDLKPLAI DTKTYNINDP YTATALNISG YTLTTTPANE      1020
     KGVFGASDET VNYVYKANDY TLTTTYKDAN GKELQAPKVD AKTYHIQDTY KTTAAIIPGY      1080
     TLVATPKNDQ GTFGASNVTV NYVYQTNDYT LTSTFKDAQG NELKAAEVDA QKYHIHDTYT      1140
     SKAAVIPGYS LEKTPTNETG TFNASDIQVN YVYKANDYQL TSTFKDQQGN EIALPTVDAK      1200
     TYHIHDAYTT KAHLIPGYSL VAAPKNQIGA FGTSDVTVNY VYKKDAIIKP ITPAKPTILT      1260
     IKTPESKVVK TKVVKQTLPK TGDDDAGLLN LLRLIGLVLI LGVFLAVGSK KLR             1313
//

If you have problems or comments...

PBIL Back to PBIL home page