(data stored in ACNUC10821 zone)

EMBL: AE017262.PE342

AE017262.PE342       Location/Qualifiers
FT   CDS             368767..369495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0346"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:16412782"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0346"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03132"
FT                   /protein_id="AAT03132.1"
FT                   /translation="MYDIYCKEFHKGRGDSLLEKKYQIHLQNHYDATSRQVQKKEIKVL
FT                   KKHNNLLNGEVFPYQICLESTMEYSRFMLWFEKEVQKIVKELWNQHFIIKLTLSQLHFR
FT                   ETILFLEHLKDFSKRITIEFIGEDTPEIKKHFSIQEQEAFFIGKLRMLKKWKFIISKHI
FT                   EGCSVEQTLAFTPCLHEIKYTMSQQARMEENIIDLHMFIDFWEYWATHKKLKFVVEVKE
FT                   KDFITKSLMHKKVHVQFENA"
     MYDIYCKEFH KGRGDSLLEK KYQIHLQNHY DATSRQVQKK EIKVLKKHNN LLNGEVFPYQ        60
     ICLESTMEYS RFMLWFEKEV QKIVKELWNQ HFIIKLTLSQ LHFRETILFL EHLKDFSKRI       120
     TIEFIGEDTP EIKKHFSIQE QEAFFIGKLR MLKKWKFIIS KHIEGCSVEQ TLAFTPCLHE       180
     IKYTMSQQAR MEENIIDLHM FIDFWEYWAT HKKLKFVVEV KEKDFITKSL MHKKVHVQFE       240
     NA                                                                      242
//

If you have problems or comments...

PBIL Back to PBIL home page