(data stored in ACNUC10821 zone)

EMBL: AE017262.PE345

AE017262.PE345       Location/Qualifiers
FT   CDS             372153..375296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0349"
FT                   /product="cell wall surface anchor family protein"
FT                   /note="identified by match to protein family HMM PF00560;
FT                   match to protein family HMM PF08191; match to protein
FT                   family HMM TIGR01167; match to protein family HMM
FT                   TIGR02543"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0349"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03135"
FT                   /protein_id="AAT03135.1"
FT                   /translation="MAEENESKSVNTETTLEPKVALEEKTPQKPTLTNNLKQEKTVLQA
FT                   GETYETVFPDAALATVIAKAATGSEDITQEVSQTDLNKITSLTATSKGIVDLTGIDLLS
FT                   KLTSLSISGNQITDISALNGLVNLSNLNVSNNKITSFNLNANSNLPMLSAVDIRSNNLK
FT                   NINVQDQPKLWTFKCDTGSSSELTEVTLKNLPTLIVAGNGSSAYQNDIVFSSTPGLSKV
FT                   ILENLPSISSSVRLDRCAIEELVINNLPKVSMVNISNNKITTLEGLENLSAVNTLYVSE
FT                   NLVTEIESMHAFPKLQKLELGWNALTNVVMDQVTAEKFPLLRTMNVRGNNLIKINIQDQ
FT                   PKLWTFECDTGSSSELTEVTLKNLPILIAVGNGSSAYQDDIVFSSTPGLSKVILENLPS
FT                   TSSEVKLDHCAIEELVINNLPKVSVVIISYNKITTLEGLENLSAVSKIDAYENLVTEIE
FT                   NLHAFPKLQTLTVDNNHISVLPTSLKTENPVLTTLSAMNQTITLKQKVIVSDLVLDNEV
FT                   KNFGQITTAKSISNKGTYQNNQIKWLFEDIKSVNAVDYQFSEPVQEATIQGTFSGKVTQ
FT                   PIKASKVPVISADAEMNYPKNETVSEAAFFKDISASVTDDATLTSDFESVVDFAKAGTY
FT                   EVTLNAVNEDGVKAASVTVLVHIAKSPAPVITADKEITYTKNAEVSITEYLAAIHAKTN
FT                   DGSPIESDFATAVNWGTAGDYTVTLRSTNEDGVEAIPVEVTVHIAKSPAPVITADKEIT
FT                   YAKNAEVSITEFLAAIHAKTSDGSSIEADLDTAVTWGTAGDYTVTLRSTNEDGVEAIPV
FT                   EVTVHIAKSPAPVITADKEITYAKNAEVSITEFLAAIHAKTSDGSPIESDFATAVIWST
FT                   AGDYTVTLKSTNEDGVEAIPVEVKVHIVEPLAPTISNVTFDVDDVQTTESLEAGELISE
FT                   PLSPTKEGYTFIGWYDSKTGGNKWDFTTDKMPAYNIILYAQFSKDTNKAEAAGGDKPST
FT                   PSSIKVSPTGQSESGNLENRSNIKLPATGDDNATVLLVGFGLLMLGLFIRLTQKKRAK"
     MAEENESKSV NTETTLEPKV ALEEKTPQKP TLTNNLKQEK TVLQAGETYE TVFPDAALAT        60
     VIAKAATGSE DITQEVSQTD LNKITSLTAT SKGIVDLTGI DLLSKLTSLS ISGNQITDIS       120
     ALNGLVNLSN LNVSNNKITS FNLNANSNLP MLSAVDIRSN NLKNINVQDQ PKLWTFKCDT       180
     GSSSELTEVT LKNLPTLIVA GNGSSAYQND IVFSSTPGLS KVILENLPSI SSSVRLDRCA       240
     IEELVINNLP KVSMVNISNN KITTLEGLEN LSAVNTLYVS ENLVTEIESM HAFPKLQKLE       300
     LGWNALTNVV MDQVTAEKFP LLRTMNVRGN NLIKINIQDQ PKLWTFECDT GSSSELTEVT       360
     LKNLPILIAV GNGSSAYQDD IVFSSTPGLS KVILENLPST SSEVKLDHCA IEELVINNLP       420
     KVSVVIISYN KITTLEGLEN LSAVSKIDAY ENLVTEIENL HAFPKLQTLT VDNNHISVLP       480
     TSLKTENPVL TTLSAMNQTI TLKQKVIVSD LVLDNEVKNF GQITTAKSIS NKGTYQNNQI       540
     KWLFEDIKSV NAVDYQFSEP VQEATIQGTF SGKVTQPIKA SKVPVISADA EMNYPKNETV       600
     SEAAFFKDIS ASVTDDATLT SDFESVVDFA KAGTYEVTLN AVNEDGVKAA SVTVLVHIAK       660
     SPAPVITADK EITYTKNAEV SITEYLAAIH AKTNDGSPIE SDFATAVNWG TAGDYTVTLR       720
     STNEDGVEAI PVEVTVHIAK SPAPVITADK EITYAKNAEV SITEFLAAIH AKTSDGSSIE       780
     ADLDTAVTWG TAGDYTVTLR STNEDGVEAI PVEVTVHIAK SPAPVITADK EITYAKNAEV       840
     SITEFLAAIH AKTSDGSPIE SDFATAVIWS TAGDYTVTLK STNEDGVEAI PVEVKVHIVE       900
     PLAPTISNVT FDVDDVQTTE SLEAGELISE PLSPTKEGYT FIGWYDSKTG GNKWDFTTDK       960
     MPAYNIILYA QFSKDTNKAE AAGGDKPSTP SSIKVSPTGQ SESGNLENRS NIKLPATGDD      1020
     NATVLLVGFG LLMLGLFIRL TQKKRAK                                          1047
//

If you have problems or comments...

PBIL Back to PBIL home page