(data stored in ACNUC10821 zone)

EMBL: AE017262.PE346

AE017262.PE346       Location/Qualifiers
FT   CDS             375686..381013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0350"
FT                   /product="cell wall surface anchor family protein"
FT                   /note="identified by match to protein family HMM PF00560;
FT                   match to protein family HMM PF06458; match to protein
FT                   family HMM PF07523; match to protein family HMM PF08191;
FT                   match to protein family HMM TIGR01167"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0350"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03136"
FT                   /db_xref="GOA:Q723X5"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR009459"
FT                   /db_xref="InterPro:IPR012569"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR025875"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q723X5"
FT                   /protein_id="AAT03136.1"
FT                   /translation="MKKKFSIVIISVLLLGYLAPFDTLLVGADETTVTEDTTVKTAETE
FT                   TATEATESESGSDNEKAEEPKEAEASKETTEKEEKAKTKEPASNIKTEINTDKSQLKQT
FT                   NLKAVVPAGSTYNSLFPDDNLAKKLAVIITGNAAATGNESVDSAALLAISQLDLSGETG
FT                   NDPTDISNIEGLQYLENLTSLNLSENNISDLAPIKDLVNLVSLNLSSNRTLVNLSGVEG
FT                   LVNLQELNVSANKALEDISQVAALPVLKEISAQGCNIKTLELDNPAGAILPELETFYLQ
FT                   ENDLTDLTSLAKLPKLKNLYIKGNASLKSLATLKGATKLQLIDASNCTDLETLGDISGL
FT                   SELEMIQLSGCSKLKEITSLKDLPNLVNITADSCAIEDLGTLNNLPKLQTLILSDNKDL
FT                   TNINAITDMPQLKTLALDGCGITSIGTLDNLPKLEKLDLKENQLTSISEINDLPRLSYL
FT                   DVSVNYLTTIGELKKLPLLEWLNVSSNRLSDVSTLTNFPSLNYINVSNNVIRTVGKMTE
FT                   LPSLKEFYAQNNNVSDISMIHDMPNLRKVDASNNLITNIGTFDNLPKLQNLDVHSNRIT
FT                   NTSVIHDLPSLETFYAQNNLITNIGTMDNLPELTYVDLSFNRIPSLAPIGDLPKLEILK
FT                   VTDNYSYLRSLGTMDGVSKLRNLELQNNYLNYTGTEGNLSALSDLTNLTELNLRDNGYI
FT                   SDISGLSTLSRLIYLNLDSNKIKDISALSNLTTLQELTLENNQIEDISALSDLDNLNKL
FT                   ALSKNKIIDISPAANMVNRGASVTASNQTYTLPTVLSYQSSFTIDNPVVWYDGTPLAPS
FT                   SIAHSGTYKDGEITWTNMTAASSSTEFNFNRLKDGLTFSGTITQPYKSAVKVTANAEQT
FT                   YTIGDTISEEQFLKDVNAKSSDGAPVTSDFATVVDLNTFGEYEVTLTSEKDGIQGDSCK
FT                   VIVKVLHGAPVISADQTINYDKHATITEKQFLEDVHASTDLNTAITTNFSTAVNLNKGG
FT                   DYTVALNSENEDGVKAETVYVTVTVDKDPAPIISAKTDITYDKFSKKTEAAFLDDIDAD
FT                   TNDGSIITSNFATAVNLDKAGDYTVTLNSINSDGVASTPTAIIVHVEKEKIATISANTA
FT                   QQYEKYAEINETQFLKDVHASINASPTTAVLESDFETVVKLDVPGTYTVTITATNEDGG
FT                   VSAPKEVSVIVKKLPAPEITADKEITYPKFDEVSEAEFLSDIHATINEKNVTITSNFSA
FT                   DVNLNKAGDYTVTLNATNEDGVKATPVEVIVHVQQGERPVITADATISYDKFANITEAK
FT                   FLEDIHATSSDGQSSTVITSNFETATNFKTAMSYTVTLNAVNEDGISAEPVAVTVTINK
FT                   EPAATLKADAEVSYAKNEAVTESDFFKDVHLEGAEAPSTAKATSNFDSVVDRSKTGDYT
FT                   VTINATNEDGAVSTPIEVIVHIGAESAPVITANAEVKYNKHEQTDERRFLYDSDAKIDE
FT                   ANVEIKTDFAEKVDINKVGTYTVTLTATNEDGQAANPVEVSVIVSDAAAEKVNVKYVDE
FT                   NGAEISAAETLTGNLDDAFSIDAKSIAGYKCDATLSGVFSTVEQTVVFHYKAIEPGVVT
FT                   IKYEDANGKAVAEDKQITGEVGDDFEAEAQTVSGYSCRAIASGKITEEPQTITFTYTTA
FT                   TPSKKSGEITVQYVDESGKKLADSKKVTGDIDDSYSVEAKAIDGYSVVGDDSAKGVFTE
FT                   KSQTVTFKYKKNTQVSKDEPKVKGKTNQPPSADTKLKVDNNTLPATGDTENMALAVLIG
FT                   FNMLLVASIFLFRKPKTNQ"
     MKKKFSIVII SVLLLGYLAP FDTLLVGADE TTVTEDTTVK TAETETATEA TESESGSDNE        60
     KAEEPKEAEA SKETTEKEEK AKTKEPASNI KTEINTDKSQ LKQTNLKAVV PAGSTYNSLF       120
     PDDNLAKKLA VIITGNAAAT GNESVDSAAL LAISQLDLSG ETGNDPTDIS NIEGLQYLEN       180
     LTSLNLSENN ISDLAPIKDL VNLVSLNLSS NRTLVNLSGV EGLVNLQELN VSANKALEDI       240
     SQVAALPVLK EISAQGCNIK TLELDNPAGA ILPELETFYL QENDLTDLTS LAKLPKLKNL       300
     YIKGNASLKS LATLKGATKL QLIDASNCTD LETLGDISGL SELEMIQLSG CSKLKEITSL       360
     KDLPNLVNIT ADSCAIEDLG TLNNLPKLQT LILSDNKDLT NINAITDMPQ LKTLALDGCG       420
     ITSIGTLDNL PKLEKLDLKE NQLTSISEIN DLPRLSYLDV SVNYLTTIGE LKKLPLLEWL       480
     NVSSNRLSDV STLTNFPSLN YINVSNNVIR TVGKMTELPS LKEFYAQNNN VSDISMIHDM       540
     PNLRKVDASN NLITNIGTFD NLPKLQNLDV HSNRITNTSV IHDLPSLETF YAQNNLITNI       600
     GTMDNLPELT YVDLSFNRIP SLAPIGDLPK LEILKVTDNY SYLRSLGTMD GVSKLRNLEL       660
     QNNYLNYTGT EGNLSALSDL TNLTELNLRD NGYISDISGL STLSRLIYLN LDSNKIKDIS       720
     ALSNLTTLQE LTLENNQIED ISALSDLDNL NKLALSKNKI IDISPAANMV NRGASVTASN       780
     QTYTLPTVLS YQSSFTIDNP VVWYDGTPLA PSSIAHSGTY KDGEITWTNM TAASSSTEFN       840
     FNRLKDGLTF SGTITQPYKS AVKVTANAEQ TYTIGDTISE EQFLKDVNAK SSDGAPVTSD       900
     FATVVDLNTF GEYEVTLTSE KDGIQGDSCK VIVKVLHGAP VISADQTINY DKHATITEKQ       960
     FLEDVHASTD LNTAITTNFS TAVNLNKGGD YTVALNSENE DGVKAETVYV TVTVDKDPAP      1020
     IISAKTDITY DKFSKKTEAA FLDDIDADTN DGSIITSNFA TAVNLDKAGD YTVTLNSINS      1080
     DGVASTPTAI IVHVEKEKIA TISANTAQQY EKYAEINETQ FLKDVHASIN ASPTTAVLES      1140
     DFETVVKLDV PGTYTVTITA TNEDGGVSAP KEVSVIVKKL PAPEITADKE ITYPKFDEVS      1200
     EAEFLSDIHA TINEKNVTIT SNFSADVNLN KAGDYTVTLN ATNEDGVKAT PVEVIVHVQQ      1260
     GERPVITADA TISYDKFANI TEAKFLEDIH ATSSDGQSST VITSNFETAT NFKTAMSYTV      1320
     TLNAVNEDGI SAEPVAVTVT INKEPAATLK ADAEVSYAKN EAVTESDFFK DVHLEGAEAP      1380
     STAKATSNFD SVVDRSKTGD YTVTINATNE DGAVSTPIEV IVHIGAESAP VITANAEVKY      1440
     NKHEQTDERR FLYDSDAKID EANVEIKTDF AEKVDINKVG TYTVTLTATN EDGQAANPVE      1500
     VSVIVSDAAA EKVNVKYVDE NGAEISAAET LTGNLDDAFS IDAKSIAGYK CDATLSGVFS      1560
     TVEQTVVFHY KAIEPGVVTI KYEDANGKAV AEDKQITGEV GDDFEAEAQT VSGYSCRAIA      1620
     SGKITEEPQT ITFTYTTATP SKKSGEITVQ YVDESGKKLA DSKKVTGDID DSYSVEAKAI      1680
     DGYSVVGDDS AKGVFTEKSQ TVTFKYKKNT QVSKDEPKVK GKTNQPPSAD TKLKVDNNTL      1740
     PATGDTENMA LAVLIGFNML LVASIFLFRK PKTNQ                                 1775
//

If you have problems or comments...

PBIL Back to PBIL home page