(data stored in ACNUC10821 zone)

EMBL: AE017262.PE347

AE017262.PE347       Location/Qualifiers
FT   CDS             381237..381761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0351"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0351"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03137"
FT                   /protein_id="AAT03137.1"
FT                   /translation="MNKMIIYSSQYGTSKKYATELSQKKAIPMYSVESIPESIVEADEI
FT                   IYVGAIYMGKVLGFDKFSKNYKTLSSKLIVISAGMYDPTRKENTDNIELTVKENLQKTN
FT                   FLLKDIFCLKGRLDTQQLRLKHKMLVNALYKSAKRKKESDLNDNERDIVRAYEDDSQID
FT                   LNKLDGILDRV"
     MNKMIIYSSQ YGTSKKYATE LSQKKAIPMY SVESIPESIV EADEIIYVGA IYMGKVLGFD        60
     KFSKNYKTLS SKLIVISAGM YDPTRKENTD NIELTVKENL QKTNFLLKDI FCLKGRLDTQ       120
     QLRLKHKMLV NALYKSAKRK KESDLNDNER DIVRAYEDDS QIDLNKLDGI LDRV             174
//

If you have problems or comments...

PBIL Back to PBIL home page