(data stored in ACNUC10821 zone)

EMBL: AE017262.PE349

AE017262.PE349       Location/Qualifiers
FT   CDS             382259..382627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0353"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0354"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0353"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03139"
FT                   /protein_id="AAT03139.1"
FT                   /translation="MDSAHRQLEQQLQQIKKAKIMAETDVDQTRRKQNEQDWLEEDSHQ
FT                   LTQEKLVLLDFLRSGWQGEEASGFHRFLEEQQHEESQAWRRDLQDKRSDLDTELQENKA
FT                   RLHTLETKQATLQKEWSK"
     MDSAHRQLEQ QLQQIKKAKI MAETDVDQTR RKQNEQDWLE EDSHQLTQEK LVLLDFLRSG        60
     WQGEEASGFH RFLEEQQHEE SQAWRRDLQD KRSDLDTELQ ENKARLHTLE TKQATLQKEW       120
     SK                                                                      122
//

If you have problems or comments...

PBIL Back to PBIL home page