(data stored in ACNUC10821 zone)

EMBL: AE017262.PE35

AE017262.PE35        Location/Qualifiers
FT   CDS             complement(37707..38156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0037"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to SP:P37490"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0037"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02825"
FT                   /protein_id="AAT02825.1"
FT                   /translation="MIIIKNFASKNIRLIMALVIGVLVFAPVFHSKAADNNIGFDFKLK
FT                   PNCANSGSSSRYRETSSVNNPWKVRLDNSTEGKGTIASFWLGTYNKNKNAVQGSTIMNV
FT                   KQGAKTRYCGAYKVANKNTTYLAAENNNYNSKTYYVDGIWDEETW"
     MIIIKNFASK NIRLIMALVI GVLVFAPVFH SKAADNNIGF DFKLKPNCAN SGSSSRYRET        60
     SSVNNPWKVR LDNSTEGKGT IASFWLGTYN KNKNAVQGST IMNVKQGAKT RYCGAYKVAN       120
     KNTTYLAAEN NNYNSKTYYV DGIWDEETW                                         149
//

If you have problems or comments...

PBIL Back to PBIL home page