(data stored in ACNUC10821 zone)

EMBL: AE017262.PE350

AE017262.PE350       Location/Qualifiers
FT   CDS             382624..384060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0354"
FT                   /product="conserved domain protein"
FT                   /note="identified by match to protein family HMM PF06860"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0354"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03140"
FT                   /protein_id="AAT03140.1"
FT                   /translation="MSRIDIAELNDFLHGLRSSNAEAKAMIRKIKEAAMDYAQDNRLKG
FT                   EAVSTSKRYFSSTYTSICQSIIEALDESEERLAQYIREFGSQVDSSPSARIDAEILQEA
FT                   MAKVSQLQRKEEDLHRQLTAPNTKPDMQQVYAVKSRSVHTQLLKAIEKENILERYLAFE
FT                   QSHGQFFSALDELIRATGRAVQELLHHVTFNDKTGTYSVPKSAVNSLLLMKKALDNART
FT                   ENDQDPFPKAFEDYTVLAYTYVNDQGETVTMWLLEKDGKRVENKELQDFLEKHGQELDP
FT                   LLYTNLSGEELERKVNDSWKEGINYLNGQKVSGFSGATLRSSAYVASMKDWTDDAGLTD
FT                   MALGLGFGIAAARNKAIIPKESSGLKFDDIEKLENHFTKHGGEFKGAYSNINEYLKGAN
FT                   NVIKNGEKVQYNYTLKDGTTELRTGYVKFMGNTSKGKAKFEFVGTNLSGDITTYHVKRG
FT                   EDVYKLLNGNKHINVINPIE"
     MSRIDIAELN DFLHGLRSSN AEAKAMIRKI KEAAMDYAQD NRLKGEAVST SKRYFSSTYT        60
     SICQSIIEAL DESEERLAQY IREFGSQVDS SPSARIDAEI LQEAMAKVSQ LQRKEEDLHR       120
     QLTAPNTKPD MQQVYAVKSR SVHTQLLKAI EKENILERYL AFEQSHGQFF SALDELIRAT       180
     GRAVQELLHH VTFNDKTGTY SVPKSAVNSL LLMKKALDNA RTENDQDPFP KAFEDYTVLA       240
     YTYVNDQGET VTMWLLEKDG KRVENKELQD FLEKHGQELD PLLYTNLSGE ELERKVNDSW       300
     KEGINYLNGQ KVSGFSGATL RSSAYVASMK DWTDDAGLTD MALGLGFGIA AARNKAIIPK       360
     ESSGLKFDDI EKLENHFTKH GGEFKGAYSN INEYLKGANN VIKNGEKVQY NYTLKDGTTE       420
     LRTGYVKFMG NTSKGKAKFE FVGTNLSGDI TTYHVKRGED VYKLLNGNKH INVINPIE         478
//

If you have problems or comments...

PBIL Back to PBIL home page