(data stored in ACNUC10821 zone)

EMBL: AE017262.PE351

AE017262.PE351       Location/Qualifiers
FT   CDS             384072..384467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0355"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01PM0501"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0355"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03141"
FT                   /protein_id="AAT03141.1"
FT                   /translation="MRYEAKIISENPNIEEELKIKIKDIELLCFVEEYKCSVEVGQEYI
FT                   VELETVVFDDLDIEKSTLQAKEITQVADSFAYFIRGVFHPSSKKIDSGIEIDLADEDIS
FT                   DFWYLENQFVALNVDRFNIDVIEKVNK"
     MRYEAKIISE NPNIEEELKI KIKDIELLCF VEEYKCSVEV GQEYIVELET VVFDDLDIEK        60
     STLQAKEITQ VADSFAYFIR GVFHPSSKKI DSGIEIDLAD EDISDFWYLE NQFVALNVDR       120
     FNIDVIEKVN K                                                            131
//

If you have problems or comments...

PBIL Back to PBIL home page