(data stored in ACNUC10821 zone)

EMBL: AE017262.PE353

AE017262.PE353       Location/Qualifiers
FT   CDS             384828..385058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0357"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01NM00296"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0357"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03143"
FT                   /protein_id="AAT03143.1"
FT                   /translation="MKQCPVCENYTIEANYDICEVCYWEYDVVAQEYPDEIIGANNISL
FT                   KQAKINYAKFCAVEEKYITLVRKPRQDELPE"
     MKQCPVCENY TIEANYDICE VCYWEYDVVA QEYPDEIIGA NNISLKQAKI NYAKFCAVEE        60
     KYITLVRKPR QDELPE                                                        76
//

If you have problems or comments...

PBIL Back to PBIL home page