(data stored in ACNUC10821 zone)

EMBL: AE017262.PE355

AE017262.PE355       Location/Qualifiers
FT   CDS             385524..385793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0359"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0359"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03145"
FT                   /protein_id="AAT03145.1"
FT                   /translation="MKQLKKLTTEQSFEYYLSSLCMLGLHTINLSDEEIEYEIFEELAI
FT                   DYPAALSPYTRELLVDNDIIDRGLSLLSKQLQTKLFELDGGILW"
     MKQLKKLTTE QSFEYYLSSL CMLGLHTINL SDEEIEYEIF EELAIDYPAA LSPYTRELLV        60
     DNDIIDRGLS LLSKQLQTKL FELDGGILW                                          89
//

If you have problems or comments...

PBIL Back to PBIL home page