(data stored in ACNUC10821 zone)

EMBL: AE017262.PE359

AE017262.PE359       Location/Qualifiers
FT   CDS             complement(388476..389132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0363"
FT                   /product="transaldolase"
FT                   /note="identified by match to protein family HMM PF00923;
FT                   match to protein family HMM TIGR00875"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0363"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03149"
FT                   /db_xref="GOA:Q723W2"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR004731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="InterPro:IPR022999"
FT                   /db_xref="InterPro:IPR033919"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q723W2"
FT                   /protein_id="AAT03149.1"
FT                   /translation="MKFFLDTASVSEIKRISELGLVDGVTTNPTIIAKEGRPFEEVIKE
FT                   ICSIVDGPVSAEVIGLEADKMVEEARILAKWAPNVVVKIPMTEEGLKAVHTLTAEGIKT
FT                   NVTLIFTVSQGLMAAKAGATYISPFLGRLDDIGTDGMILIKNLKKVLDNYGLKAEIISA
FT                   SIRHIGHLEEAAEAGAHIATIPGSLFPKLWSHPLTDKGIEGFLKDWEAFSQKEGN"
     MKFFLDTASV SEIKRISELG LVDGVTTNPT IIAKEGRPFE EVIKEICSIV DGPVSAEVIG        60
     LEADKMVEEA RILAKWAPNV VVKIPMTEEG LKAVHTLTAE GIKTNVTLIF TVSQGLMAAK       120
     AGATYISPFL GRLDDIGTDG MILIKNLKKV LDNYGLKAEI ISASIRHIGH LEEAAEAGAH       180
     IATIPGSLFP KLWSHPLTDK GIEGFLKDWE AFSQKEGN                               218
//

If you have problems or comments...

PBIL Back to PBIL home page