(data stored in ACNUC10821 zone)

EMBL: AE017262.PE363

AE017262.PE363       Location/Qualifiers
FT   CDS             complement(391189..391839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0367"
FT                   /product="dihydroxyacetone kinase"
FT                   /note="identified by similarity to GP:15082276; match to
FT                   protein family HMM PF02734; match to protein family HMM
FT                   TIGR02365"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0367"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03153"
FT                   /protein_id="AAT03153.1"
FT                   /translation="MSELVMDSAFFGHVLQDMGALIEKERDYLTGLDSDIGDGDHGINL
FT                   SIGFREVNKQLDELLTASPDIATLLKKSGMILLGKVGGASGPLYGSFFMKCGADVPGKT
FT                   EVNFDELCGMIINGAAAVQHRGKAELGDKTMMDAFLPGVEVLQNRDTNAAPIETFSAFV
FT                   DAMHAGAQSTIPLIAKKGRALRLGERAIGHLDPGSESSWMLMNVILENLKKAV"
     MSELVMDSAF FGHVLQDMGA LIEKERDYLT GLDSDIGDGD HGINLSIGFR EVNKQLDELL        60
     TASPDIATLL KKSGMILLGK VGGASGPLYG SFFMKCGADV PGKTEVNFDE LCGMIINGAA       120
     AVQHRGKAEL GDKTMMDAFL PGVEVLQNRD TNAAPIETFS AFVDAMHAGA QSTIPLIAKK       180
     GRALRLGERA IGHLDPGSES SWMLMNVILE NLKKAV                                 216
//

If you have problems or comments...

PBIL Back to PBIL home page