(data stored in ACNUC10821 zone)

EMBL: AE017262.PE364

AE017262.PE364       Location/Qualifiers
FT   CDS             complement(391861..392856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0368"
FT                   /product="dihydroxyacetone kinase"
FT                   /note="identified by similarity to GP:15082277; match to
FT                   protein family HMM PF02733"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0368"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03154"
FT                   /protein_id="AAT03154.1"
FT                   /translation="MRRLVNDGYEAVEEMLAGYVAAQGKYVDFAENDKRVIVSKQMSEE
FT                   PRVRIIVGGGSGHEPLFLGYVGKDFADAAVVGNINTSPSPEPCYNAVKAVDSGKGCLYM
FT                   YGNYAGDVMNFDMGAEMAADDGIRVETVLVTDDIYSAENVEDRRGVAGDLIVFKAAASA
FT                   AAKGLDLDAVKQAAEKANANTFSMGVALSSSTLPVTGKAIFEMKEGEMEVGMGIHGEPG
FT                   IKRTSIEPADKVVDQIMGYLIEEMKLTADEEVHVLINGLGGLPVMDQYICYRRVDEILK
FT                   EKGVHIHNPLVGNYATSMDMIGMSITLVRLDDELKDLLDTPCDTPYFKVD"
     MRRLVNDGYE AVEEMLAGYV AAQGKYVDFA ENDKRVIVSK QMSEEPRVRI IVGGGSGHEP        60
     LFLGYVGKDF ADAAVVGNIN TSPSPEPCYN AVKAVDSGKG CLYMYGNYAG DVMNFDMGAE       120
     MAADDGIRVE TVLVTDDIYS AENVEDRRGV AGDLIVFKAA ASAAAKGLDL DAVKQAAEKA       180
     NANTFSMGVA LSSSTLPVTG KAIFEMKEGE MEVGMGIHGE PGIKRTSIEP ADKVVDQIMG       240
     YLIEEMKLTA DEEVHVLING LGGLPVMDQY ICYRRVDEIL KEKGVHIHNP LVGNYATSMD       300
     MIGMSITLVR LDDELKDLLD TPCDTPYFKV D                                      331
//

If you have problems or comments...

PBIL Back to PBIL home page