(data stored in ACNUC10821 zone)

EMBL: AE017262.PE365

AE017262.PE365       Location/Qualifiers
FT   CDS             complement(392878..393219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0369"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0365"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0369"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03155"
FT                   /protein_id="AAT03155.1"
FT                   /translation="MSIGIALATIAGGFLFPFAIRMMWGKMVDEWGAIGGWMAAAFIVG
FT                   TVWTINHGIPKSMIYQSGTVWVDMAVAAGIGVFTASLLTGGKFSKSIVNLAAAVVGGVL
FT                   GGFLLSLFL"
     MSIGIALATI AGGFLFPFAI RMMWGKMVDE WGAIGGWMAA AFIVGTVWTI NHGIPKSMIY        60
     QSGTVWVDMA VAAGIGVFTA SLLTGGKFSK SIVNLAAAVV GGVLGGFLLS LFL              113
//

If you have problems or comments...

PBIL Back to PBIL home page