(data stored in ACNUC10821 zone)

EMBL: AE017262.PE366

AE017262.PE366       Location/Qualifiers
FT   CDS             complement(393235..393666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0370"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0366"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0370"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03156"
FT                   /protein_id="AAT03156.1"
FT                   /translation="MKFFRGMIGFCIAGMIVMSVWTPLAENYGIFGGYLAAFIIIGPMW
FT                   FMNHYVGLIENDEDAAFVDMAVGIGICGIMRDVFMQGGGELVSSLPTIGLVAIGAVLAG
FT                   IVAAAIEKDMAKKQEAKQEKTEPGMNMKEEERLNENQLV"
     MKFFRGMIGF CIAGMIVMSV WTPLAENYGI FGGYLAAFII IGPMWFMNHY VGLIENDEDA        60
     AFVDMAVGIG ICGIMRDVFM QGGGELVSSL PTIGLVAIGA VLAGIVAAAI EKDMAKKQEA       120
     KQEKTEPGMN MKEEERLNEN QLV                                               143
//

If you have problems or comments...

PBIL Back to PBIL home page