(data stored in ACNUC10821 zone)

EMBL: AE017262.PE367

AE017262.PE367       Location/Qualifiers
FT   CDS             complement(393751..394128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0371"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF03610;
FT                   match to protein family HMM TIGR02364"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0371"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03157"
FT                   /protein_id="AAT03157.1"
FT                   /translation="MISIVLVSHSQKITEGLQEMIVEMVGDTVHIISSGGTGDGRLGTN
FT                   AIMIADNIATCTNSEHIYIFCDIGSAILSAETALELLETDLLEKTTIIDAPLVEGAFTA
FT                   AVQSLVNPSKEAILQELTNVH"
     MISIVLVSHS QKITEGLQEM IVEMVGDTVH IISSGGTGDG RLGTNAIMIA DNIATCTNSE        60
     HIYIFCDIGS AILSAETALE LLETDLLEKT TIIDAPLVEG AFTAAVQSLV NPSKEAILQE       120
     LTNVH                                                                   125
//

If you have problems or comments...

PBIL Back to PBIL home page