(data stored in ACNUC10821 zone)

EMBL: AE017262.PE368

AE017262.PE368       Location/Qualifiers
FT   CDS             394311..395075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0372"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="identified by match to protein family HMM PF00455"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0372"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03158"
FT                   /protein_id="AAT03158.1"
FT                   /translation="MFPFERQNKIIHLLDQNSKITVPELSRILDVSISTIRNDLSSLEE
FT                   SGMIKKVHGGAVLLKSEEKFTNFNDRIIRNIEEKEAIAKEAATLVKNNQTIILDASSTA
FT                   LALAKELHGFSRLTVITSGLYTAIELKDNPNISVILTGGIVTTNSFTLEGILGANLIEN
FT                   IHADLCFMSAKGFTMEEGLTDFNIYETELKRLLAKRTNKLIALLDHTKMGVISTASITA
FT                   AENIDLLITDNKINKALYKKFQDAGLPVKIAE"
     MFPFERQNKI IHLLDQNSKI TVPELSRILD VSISTIRNDL SSLEESGMIK KVHGGAVLLK        60
     SEEKFTNFND RIIRNIEEKE AIAKEAATLV KNNQTIILDA SSTALALAKE LHGFSRLTVI       120
     TSGLYTAIEL KDNPNISVIL TGGIVTTNSF TLEGILGANL IENIHADLCF MSAKGFTMEE       180
     GLTDFNIYET ELKRLLAKRT NKLIALLDHT KMGVISTASI TAAENIDLLI TDNKINKALY       240
     KKFQDAGLPV KIAE                                                         254
//

If you have problems or comments...

PBIL Back to PBIL home page