(data stored in ACNUC10821 zone)

EMBL: AE017262.PE372

AE017262.PE372       Location/Qualifiers
FT   CDS             399222..400742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0376"
FT                   /product="fumarate reductase, flavoprotein subunit"
FT                   /EC_number="1.3.99.1"
FT                   /note="identified by similarity to SP:Q02469; match to
FT                   protein family HMM PF00890; match to protein family HMM
FT                   PF07992; match to protein family HMM TIGR01813"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0376"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03162"
FT                   /protein_id="AAT03162.1"
FT                   /translation="MKKRLATTFIMLLSLALIIAGCGSNNTSKSDTEKTKEKEKTEVTS
FT                   GASKTSYTDPSELKDKYDIVIVGAGGAGMSAALEAKAKGMNPVILEKMPLAGGNTMKAS
FT                   SGMNASETKFQKEEGINDSNDKFYEETLKGGHGTNDKAMLRFFVDNSASAIDWLDSMDI
FT                   KLNNLTITGGMSEKRTHRPEDGSAVGKYLVDGLLKNVQEQKIPVFVNADVKEITQKDGK
FT                   VTGVKVKLNNKDEKTISSDAVVVTTGGYGANKDMIEKERPDLKGYVTTNQEGSTGDGIK
FT                   MIEKLGGTTVDMDQIQVHPTVQQDKSYLIGEAVRGEGAILVSQEGKRFGNELDTRDNVT
FT                   ASINKLPEKSAYLVFDSGVKDRVKAIAQYEEMGFVEEGKTIDELAGKINVPKEELTKTL
FT                   DTWNASVKNKKDEAFGRTTAMDNDLSKAPYYAIKIGPGIHYTMGGVKINTNTEVLDKDG
FT                   KPITGLFAAGEVTGGLHGENRIGGNSVAEIIIFGRQAGDKSAEFVKAQ"
     MKKRLATTFI MLLSLALIIA GCGSNNTSKS DTEKTKEKEK TEVTSGASKT SYTDPSELKD        60
     KYDIVIVGAG GAGMSAALEA KAKGMNPVIL EKMPLAGGNT MKASSGMNAS ETKFQKEEGI       120
     NDSNDKFYEE TLKGGHGTND KAMLRFFVDN SASAIDWLDS MDIKLNNLTI TGGMSEKRTH       180
     RPEDGSAVGK YLVDGLLKNV QEQKIPVFVN ADVKEITQKD GKVTGVKVKL NNKDEKTISS       240
     DAVVVTTGGY GANKDMIEKE RPDLKGYVTT NQEGSTGDGI KMIEKLGGTT VDMDQIQVHP       300
     TVQQDKSYLI GEAVRGEGAI LVSQEGKRFG NELDTRDNVT ASINKLPEKS AYLVFDSGVK       360
     DRVKAIAQYE EMGFVEEGKT IDELAGKINV PKEELTKTLD TWNASVKNKK DEAFGRTTAM       420
     DNDLSKAPYY AIKIGPGIHY TMGGVKINTN TEVLDKDGKP ITGLFAAGEV TGGLHGENRI       480
     GGNSVAEIII FGRQAGDKSA EFVKAQ                                            506
//

If you have problems or comments...

PBIL Back to PBIL home page