(data stored in ACNUC10821 zone)

EMBL: AE017262.PE377

AE017262.PE377       Location/Qualifiers
FT   CDS             complement(406017..406634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0382"
FT                   /product="peptidase, S51 family"
FT                   /note="identified by match to protein family HMM PF03575"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0382"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03167"
FT                   /protein_id="AAT03167.1"
FT                   /translation="MKNLFLTSSFKDVVPLFTEFESNLQGKTVTFIPTASTVEEVVFYV
FT                   EAGKKALEDLGLIVEELDVAAENLEEITMTLKKNDFIYVTGGNTFFLLQELKRTGADKL
FT                   ILEEIAKGKLYIGESAGAVITSPNISYIQSMDSVKKATNLTNYDALNLVDFYTLPHYNN
FT                   TPFKKITQQIIADYADDLKIFPISNCETIFVQGNVVTSKGIL"
     MKNLFLTSSF KDVVPLFTEF ESNLQGKTVT FIPTASTVEE VVFYVEAGKK ALEDLGLIVE        60
     ELDVAAENLE EITMTLKKND FIYVTGGNTF FLLQELKRTG ADKLILEEIA KGKLYIGESA       120
     GAVITSPNIS YIQSMDSVKK ATNLTNYDAL NLVDFYTLPH YNNTPFKKIT QQIIADYADD       180
     LKIFPISNCE TIFVQGNVVT SKGIL                                             205
//

If you have problems or comments...

PBIL Back to PBIL home page