(data stored in ACNUC10821 zone)

EMBL: AE017262.PE386

AE017262.PE386       Location/Qualifiers
FT   CDS             413508..413702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0391"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0392"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0391"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03176"
FT                   /protein_id="AAT03176.1"
FT                   /translation="MKYVKSQMKELVKDSVDLQERLQKLMKEMDLEKTFALKALYHSEV
FT                   ADGGPYQTAYQDLDYKYKD"
     MKYVKSQMKE LVKDSVDLQE RLQKLMKEMD LEKTFALKAL YHSEVADGGP YQTAYQDLDY        60
     KYKD                                                                     64
//

If you have problems or comments...

PBIL Back to PBIL home page