(data stored in ACNUC10821 zone)

EMBL: AE017262.PE387

AE017262.PE387       Location/Qualifiers
FT   CDS             complement(413741..414661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0392"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0393"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0392"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03177"
FT                   /protein_id="AAT03177.1"
FT                   /translation="MKIERLIGIIMLLLQRELVSASEMATMFEVSKRTIFRDIDTLAMA
FT                   NIPIYTIAGTKGGIGIMPTYKVDKKLLTVDDLTAIIASLDGMEQLLSSAETKKTLQKMK
FT                   NMLDHSSEPPKSSISLDFSNLSMKNELNAKVESLYLAIKKHQLVELSYIDRTGNQTIRK
FT                   TEPYHLLFRNRSWYLQGYSLERSDFRTFKMSRIVELKTLEETFEARPFSVKPFGAPPDR
FT                   PMFLMHEVNLIVDKIAREQIIERFDLVEISQQDDAHFLAKVTLPDHEAGYRFLLQLGTH
FT                   VTIQNRDDFYDNFVDYLKEIQGKYI"
     MKIERLIGII MLLLQRELVS ASEMATMFEV SKRTIFRDID TLAMANIPIY TIAGTKGGIG        60
     IMPTYKVDKK LLTVDDLTAI IASLDGMEQL LSSAETKKTL QKMKNMLDHS SEPPKSSISL       120
     DFSNLSMKNE LNAKVESLYL AIKKHQLVEL SYIDRTGNQT IRKTEPYHLL FRNRSWYLQG       180
     YSLERSDFRT FKMSRIVELK TLEETFEARP FSVKPFGAPP DRPMFLMHEV NLIVDKIARE       240
     QIIERFDLVE ISQQDDAHFL AKVTLPDHEA GYRFLLQLGT HVTIQNRDDF YDNFVDYLKE       300
     IQGKYI                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page