(data stored in ACNUC10821 zone)

EMBL: AE017262.PE388

AE017262.PE388       Location/Qualifiers
FT   CDS             414764..415183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0393"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0394"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0393"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03178"
FT                   /protein_id="AAT03178.1"
FT                   /translation="MAFEIVELKKETFTGNKVEIPEFDPQKGFGPMSEIKESAHTKFAK
FT                   NEKDYVGINASLDDLQYYIVASAKGENGDTTFDIPEGKYAKFVTSETDRPALDGFIGAA
FT                   YGEVSQSDTVGIAGSFNLEDLREAEFTLYIPVVSK"
     MAFEIVELKK ETFTGNKVEI PEFDPQKGFG PMSEIKESAH TKFAKNEKDY VGINASLDDL        60
     QYYIVASAKG ENGDTTFDIP EGKYAKFVTS ETDRPALDGF IGAAYGEVSQ SDTVGIAGSF       120
     NLEDLREAEF TLYIPVVSK                                                    139
//

If you have problems or comments...

PBIL Back to PBIL home page