(data stored in ACNUC10821 zone)

EMBL: AE017262.PE389

AE017262.PE389       Location/Qualifiers
FT   CDS             complement(415232..415993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0394"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="identified by match to protein family HMM PF00455"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0394"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03179"
FT                   /protein_id="AAT03179.1"
FT                   /translation="MKVQRIQAIENLIHEKGSISLDDLCEQFNVSKNTVRRDIAKLLQK
FT                   NTIQKVYGGVVSVYNNPEEIRPFENRDTENHTEKQLIGKAAADFIEENDLIFIDSGTTT
FT                   SCLAAALPTDKDITIITNSLDVINFASEMDNVKLIVIGSTFKTSTKSFVGVENWGFFEK
FT                   YNITKAFMAATALSTTHGVMNSDILEYEIKRHMMEKAREKFLLVDHTKVDKSALLTYGE
FT                   LAEFDWLVTSKDMAGGCLGYCEDVGVLVRLV"
     MKVQRIQAIE NLIHEKGSIS LDDLCEQFNV SKNTVRRDIA KLLQKNTIQK VYGGVVSVYN        60
     NPEEIRPFEN RDTENHTEKQ LIGKAAADFI EENDLIFIDS GTTTSCLAAA LPTDKDITII       120
     TNSLDVINFA SEMDNVKLIV IGSTFKTSTK SFVGVENWGF FEKYNITKAF MAATALSTTH       180
     GVMNSDILEY EIKRHMMEKA REKFLLVDHT KVDKSALLTY GELAEFDWLV TSKDMAGGCL       240
     GYCEDVGVLV RLV                                                          253
//

If you have problems or comments...

PBIL Back to PBIL home page