(data stored in ACNUC10821 zone)

EMBL: AE017262.PE39

AE017262.PE39        Location/Qualifiers
FT   CDS             40837..41802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0041"
FT                   /product="ROK family protein"
FT                   /note="identified by match to protein family HMM PF00480"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0041"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02829"
FT                   /protein_id="AAT02829.1"
FT                   /translation="MDIQESVIGIDLGGTKILIGEVTKDGEVLNSKSYPSNTENQTKAT
FT                   EILLKVLDDYTQNIGFIAPKQTGIGVGLVGRVNHKSGVWLEIEPGKSNPTPLADILEAK
FT                   TGLPVSLGNDVVCATMAEKQFGWGQETNDFIYLNVGTGLAAGFVVDGRITQGGHFNAGE
FT                   IGHAVVDIHSDVLCGCGRRGCVERLASGLGIKEEALRRLNNYPTSILAEAETELTGKMV
FT                   LHAAEQKDELAEEIIDNATFQLANLIMNLVRTTDPECVILGGGVTQNEHFFQKILGNLQ
FT                   SNTIRFVTKGVVRSKLEKDKVGLIGAAVIGMRLGNEGGKE"
     MDIQESVIGI DLGGTKILIG EVTKDGEVLN SKSYPSNTEN QTKATEILLK VLDDYTQNIG        60
     FIAPKQTGIG VGLVGRVNHK SGVWLEIEPG KSNPTPLADI LEAKTGLPVS LGNDVVCATM       120
     AEKQFGWGQE TNDFIYLNVG TGLAAGFVVD GRITQGGHFN AGEIGHAVVD IHSDVLCGCG       180
     RRGCVERLAS GLGIKEEALR RLNNYPTSIL AEAETELTGK MVLHAAEQKD ELAEEIIDNA       240
     TFQLANLIMN LVRTTDPECV ILGGGVTQNE HFFQKILGNL QSNTIRFVTK GVVRSKLEKD       300
     KVGLIGAAVI GMRLGNEGGK E                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page