(data stored in ACNUC10821 zone)

EMBL: AE017262.PE391

AE017262.PE391       Location/Qualifiers
FT   CDS             417667..418488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0396"
FT                   /product="putative iolB protein"
FT                   /note="identified by similarity to SP:P42413; match to
FT                   protein family HMM PF06845"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0396"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03181"
FT                   /db_xref="GOA:Q723T0"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR021120"
FT                   /db_xref="InterPro:IPR023770"
FT                   /db_xref="InterPro:IPR024203"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q723T0"
FT                   /protein_id="AAT03181.1"
FT                   /translation="MGKLLRKPLNERIAPGITFVQDINQANSPLSYVGFRLIEMEKGAI
FT                   YQEELTDLECCIVALTGKITVSEGDNIFAEIGTRANVFEKIPTDSVFISGGRTFQVKAD
FT                   TEKARVALCYSQANRDLPTTLIKASDNSIEQRGKYQNKRLVHNILPDVSEVASSLLVVE
FT                   VYTDGGNFSSYPPHKHDRDNLPAESLLEESYYHEINPEQGFIFQRVYTDDRTLDETMAV
FT                   EHQNAVIVPEGYHPVGVPDGYDSYYLNVMAGPKRVWKFHNDPDHEWILERD"
     MGKLLRKPLN ERIAPGITFV QDINQANSPL SYVGFRLIEM EKGAIYQEEL TDLECCIVAL        60
     TGKITVSEGD NIFAEIGTRA NVFEKIPTDS VFISGGRTFQ VKADTEKARV ALCYSQANRD       120
     LPTTLIKASD NSIEQRGKYQ NKRLVHNILP DVSEVASSLL VVEVYTDGGN FSSYPPHKHD       180
     RDNLPAESLL EESYYHEINP EQGFIFQRVY TDDRTLDETM AVEHQNAVIV PEGYHPVGVP       240
     DGYDSYYLNV MAGPKRVWKF HNDPDHEWIL ERD                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page