(data stored in ACNUC10821 zone)

EMBL: AE017262.PE393

AE017262.PE393       Location/Qualifiers
FT   CDS             419492..421411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0398"
FT                   /product="thiamine-pyrophosphate-requiring enzyme"
FT                   /note="identified by match to protein family HMM PF00205;
FT                   match to protein family HMM PF02776"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0398"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03183"
FT                   /db_xref="GOA:Q723S8"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR023757"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR030817"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q723S8"
FT                   /protein_id="AAT03183.1"
FT                   /translation="MVTEKTIRLTTAQALVKFLNQQYIEVDGEMAPFVDGIFTLFGHGN
FT                   VVGIGQALEEAPGHLKVYQGKNEQGMAHAAIAYAKQKNRQRIYACSTSAGPGSANLITA
FT                   AGTALANNLPVLFLPADTFATRQPDPVLQQLEHESSTAITTNDGFQAVSRYFDRVQRPE
FT                   QLMSALIRAFEVMTNPASAGPATICIAQDTEGEAFDYPVEFFQKRIHYLNRQIPTKREL
FT                   TEAARLIKASKTPVIIVGGGARYSRAREELIALSEQTNIPLVETHAGKSTLEFDFKNNL
FT                   GGTGILGTLAANKAIRDADLVIGIGTRYTDFTTSSKTAFDPTTKFININVSRMQTYKLD
FT                   AFQVVGDAKATLAELAPLLKGYQTQFGNKIAAYKTEWLDERARLQTTKFNRETFTPEIK
FT                   DQFDQAILNEYADRLQTEFTQTEALITINDNVAPDSIVVCSAGSLPGDLQRLWNPAVPD
FT                   TYHLEYGYSCMGYEINGALGAKMAAAKKQEVYAIVGDGSFCMSHSELLTSLQYGKKINI
FT                   MLFDNSGFGCINNLQMANGSDSFFCEFRDSDNQIMQVDYAKIAEGYGAKVYRANTKEDL
FT                   ISALEDAKTQSKTTLIEMKVLPKTMSEGYLNWWNVGVSEVSNKESIKQAYEEKQANLKN
FT                   ARLY"
     MVTEKTIRLT TAQALVKFLN QQYIEVDGEM APFVDGIFTL FGHGNVVGIG QALEEAPGHL        60
     KVYQGKNEQG MAHAAIAYAK QKNRQRIYAC STSAGPGSAN LITAAGTALA NNLPVLFLPA       120
     DTFATRQPDP VLQQLEHESS TAITTNDGFQ AVSRYFDRVQ RPEQLMSALI RAFEVMTNPA       180
     SAGPATICIA QDTEGEAFDY PVEFFQKRIH YLNRQIPTKR ELTEAARLIK ASKTPVIIVG       240
     GGARYSRARE ELIALSEQTN IPLVETHAGK STLEFDFKNN LGGTGILGTL AANKAIRDAD       300
     LVIGIGTRYT DFTTSSKTAF DPTTKFININ VSRMQTYKLD AFQVVGDAKA TLAELAPLLK       360
     GYQTQFGNKI AAYKTEWLDE RARLQTTKFN RETFTPEIKD QFDQAILNEY ADRLQTEFTQ       420
     TEALITINDN VAPDSIVVCS AGSLPGDLQR LWNPAVPDTY HLEYGYSCMG YEINGALGAK       480
     MAAAKKQEVY AIVGDGSFCM SHSELLTSLQ YGKKINIMLF DNSGFGCINN LQMANGSDSF       540
     FCEFRDSDNQ IMQVDYAKIA EGYGAKVYRA NTKEDLISAL EDAKTQSKTT LIEMKVLPKT       600
     MSEGYLNWWN VGVSEVSNKE SIKQAYEEKQ ANLKNARLY                              639
//

If you have problems or comments...

PBIL Back to PBIL home page