(data stored in ACNUC10821 zone)

EMBL: AE017262.PE395

AE017262.PE395       Location/Qualifiers
FT   CDS             422009..422377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0400"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0404"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0400"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03185"
FT                   /protein_id="AAT03185.1"
FT                   /translation="MRIFCGIMSIQAGFIGALAEILSPDSKKNNLFMIPEDLAASSGYL
FT                   MSLAMVLAGILIICAYRNDFLIFMALILWLFGLIFGLIFTPSYSGFYFRPIVCLISFLM
FT                   GLFIFTDYTRHQDTGEER"
     MRIFCGIMSI QAGFIGALAE ILSPDSKKNN LFMIPEDLAA SSGYLMSLAM VLAGILIICA        60
     YRNDFLIFMA LILWLFGLIF GLIFTPSYSG FYFRPIVCLI SFLMGLFIFT DYTRHQDTGE       120
     ER                                                                      122
//

If you have problems or comments...

PBIL Back to PBIL home page