(data stored in ACNUC10821 zone)

EMBL: AE017262.PE396

AE017262.PE396       Location/Qualifiers
FT   CDS             complement(422401..423516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0401"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF06772"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0401"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03186"
FT                   /protein_id="AAT03186.1"
FT                   /translation="MAERKVSWLELFFDLIFVTAVASTTHLLLSVDNHPDKTAVYFGEY
FT                   LLMVTPMFWAWVGQTMFFNRFGEKIKLPELYMLPQMFFLILMTASFDLTFSNTYYTFLI
FT                   GYLGIRLITVIQYFVISKQLTGNARKVAILLGSVFLLGVLTTATSVFFEGFARYLVMYL
FT                   GIAVDIILPLFLAKTLRKVPVDFPHLAERFGLFVIITFGESIVAITTILVGHTLDPYTI
FT                   GYTLLGFLIICTLWASYFHSFEKIVDHHKETHGQYLIYGHFFIIISVMLLAANVHLLFE
FT                   GHLERNVLLLMLFGSVAVFFVSKQFVFAAHKKAEVTFSFWKDALLLLLLVGLFFVNLYS
FT                   DFPLFVSFVSIWVCALVDLGLQFGTSRSARM"
     MAERKVSWLE LFFDLIFVTA VASTTHLLLS VDNHPDKTAV YFGEYLLMVT PMFWAWVGQT        60
     MFFNRFGEKI KLPELYMLPQ MFFLILMTAS FDLTFSNTYY TFLIGYLGIR LITVIQYFVI       120
     SKQLTGNARK VAILLGSVFL LGVLTTATSV FFEGFARYLV MYLGIAVDII LPLFLAKTLR       180
     KVPVDFPHLA ERFGLFVIIT FGESIVAITT ILVGHTLDPY TIGYTLLGFL IICTLWASYF       240
     HSFEKIVDHH KETHGQYLIY GHFFIIISVM LLAANVHLLF EGHLERNVLL LMLFGSVAVF       300
     FVSKQFVFAA HKKAEVTFSF WKDALLLLLL VGLFFVNLYS DFPLFVSFVS IWVCALVDLG       360
     LQFGTSRSAR M                                                            371
//

If you have problems or comments...

PBIL Back to PBIL home page