(data stored in ACNUC10821 zone)

EMBL: AE017262.PE399

AE017262.PE399       Location/Qualifiers
FT   CDS             424776..425720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0404"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01SA1454; match
FT                   to protein family HMM PF07251"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0404"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03189"
FT                   /db_xref="GOA:Q723S2"
FT                   /db_xref="InterPro:IPR022853"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q723S2"
FT                   /protein_id="AAT03189.1"
FT                   /translation="MTMIGPIIIAVLIIIFLIVFFTLVPVGLWISALSARVPVGLGTLI
FT                   GMRLRRVVPSRVVKPLIKAVKAGLDLEVNQLESHYLAGGDVDNTVDALIAAHRANIELD
FT                   FSRAAAIDLAGRDVLEAVQTSVTPKVIRTPEFTGVAQNGVEVKVITQITVQSNIERIVG
FT                   GAGEDTVIARVGEAVVSTVGETREHTDVLENPNSISKKVQEQGLGDGTAYTILSIDIAE
FT                   MRIGDNIKAKLDIEKANADMEVAQAAASKRKAEAIALEQENRAAVVAAEAEVPRALSRA
FT                   LEEGNLGVMDYYKMENVQSDTAMRESIAHEDEK"
     MTMIGPIIIA VLIIIFLIVF FTLVPVGLWI SALSARVPVG LGTLIGMRLR RVVPSRVVKP        60
     LIKAVKAGLD LEVNQLESHY LAGGDVDNTV DALIAAHRAN IELDFSRAAA IDLAGRDVLE       120
     AVQTSVTPKV IRTPEFTGVA QNGVEVKVIT QITVQSNIER IVGGAGEDTV IARVGEAVVS       180
     TVGETREHTD VLENPNSISK KVQEQGLGDG TAYTILSIDI AEMRIGDNIK AKLDIEKANA       240
     DMEVAQAAAS KRKAEAIALE QENRAAVVAA EAEVPRALSR ALEEGNLGVM DYYKMENVQS       300
     DTAMRESIAH EDEK                                                         314
//

If you have problems or comments...

PBIL Back to PBIL home page