(data stored in ACNUC10821 zone)

EMBL: AE017262.PE400

AE017262.PE400       Location/Qualifiers
FT   CDS             425755..426204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0405"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:16412840"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0405"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03190"
FT                   /protein_id="AAT03190.1"
FT                   /translation="MDLSDFLNSGWESVLVVLGIVGVIINFLSKAGKGTEEENKKAPQP
FT                   RPNLRSMHQASRTQTTKKPEKRKVSQGTFTQNKEQDKVIAEQKAAQQKMLREIRRESDV
FT                   AKGKNIIKSTSSHHKKARKLRGRLQEAIITKEILDKPVSLRKNHL"
     MDLSDFLNSG WESVLVVLGI VGVIINFLSK AGKGTEEENK KAPQPRPNLR SMHQASRTQT        60
     TKKPEKRKVS QGTFTQNKEQ DKVIAEQKAA QQKMLREIRR ESDVAKGKNI IKSTSSHHKK       120
     ARKLRGRLQE AIITKEILDK PVSLRKNHL                                         149
//

If you have problems or comments...

PBIL Back to PBIL home page