(data stored in ACNUC10821 zone)

EMBL: AE017262.PE401

AE017262.PE401       Location/Qualifiers
FT   CDS             426315..427031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0406"
FT                   /product="NLP/P60 family protein"
FT                   /note="identified by match to protein family HMM PF00877"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0406"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03191"
FT                   /protein_id="AAT03191.1"
FT                   /translation="MLCVYKKGVRGLKIIATRRKIFFAFIALMISFSVLFLPTTNASAA
FT                   TTYKMTTTADVNVRAADNTKGKVIGFYKKGTTVTFTAKTKNNWYKTTYKGKVGYVSGKC
FT                   VTTYKAPVATTQSFTALNNEARKHIGKRYKIGATGPSCFDCSGYTQYVYSKGVKKSIPR
FT                   TAKQQYASAKKIKAQELKKGDLIFFNYGKGVAHVGIYVGNGKMLNAQNNGVKYDTITSG
FT                   YWKKYIAGYGRVANLK"
     MLCVYKKGVR GLKIIATRRK IFFAFIALMI SFSVLFLPTT NASAATTYKM TTTADVNVRA        60
     ADNTKGKVIG FYKKGTTVTF TAKTKNNWYK TTYKGKVGYV SGKCVTTYKA PVATTQSFTA       120
     LNNEARKHIG KRYKIGATGP SCFDCSGYTQ YVYSKGVKKS IPRTAKQQYA SAKKIKAQEL       180
     KKGDLIFFNY GKGVAHVGIY VGNGKMLNAQ NNGVKYDTIT SGYWKKYIAG YGRVANLK         238
//

If you have problems or comments...

PBIL Back to PBIL home page