(data stored in ACNUC10821 zone)

EMBL: AE017262.PE411

AE017262.PE411       Location/Qualifiers
FT   CDS             432043..432717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0416"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0416"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03201"
FT                   /protein_id="AAT03201.1"
FT                   /translation="MIQLFNISKSYQMGECTIKALDNVSLQIDQGEFLAIIGPSGSGKS
FT                   TLMNILGILDRATIGEYYLNKTNLMRISDKKISRIRNRKIGFIFQQFNLMPRLTAFENV
FT                   ELPLVYRGVGKATRKKVVLKSLERVGLLDKEKHIPAQLSGGQQQRIAIARAIAGSPELI
FT                   LADEPTGALDSKTGEEVMTLLREIHREGNTLIMITHDKEIANQAERIIEIKDGKLREWN
FT                   KL"
     MIQLFNISKS YQMGECTIKA LDNVSLQIDQ GEFLAIIGPS GSGKSTLMNI LGILDRATIG        60
     EYYLNKTNLM RISDKKISRI RNRKIGFIFQ QFNLMPRLTA FENVELPLVY RGVGKATRKK       120
     VVLKSLERVG LLDKEKHIPA QLSGGQQQRI AIARAIAGSP ELILADEPTG ALDSKTGEEV       180
     MTLLREIHRE GNTLIMITHD KEIANQAERI IEIKDGKLRE WNKL                        224
//

If you have problems or comments...

PBIL Back to PBIL home page