(data stored in ACNUC10821 zone)

EMBL: AE017262.PE414

AE017262.PE414       Location/Qualifiers
FT   CDS             434113..434595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0419"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0419"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03204"
FT                   /protein_id="AAT03204.1"
FT                   /translation="MNESICKRDNGGAVVNFELEINATKAEVFALLTTNAGLAKWFNEL
FT                   EVGELGADGYLLFVMTPEEKITMPIRAFETNQKLAFEWDQDEVDFELNEITANKTRLTF
FT                   REQLTTITEHSPRDISGWHICLKKLQASAEGKIYDFNKTEFETLFAKYQKELNIEK"
     MNESICKRDN GGAVVNFELE INATKAEVFA LLTTNAGLAK WFNELEVGEL GADGYLLFVM        60
     TPEEKITMPI RAFETNQKLA FEWDQDEVDF ELNEITANKT RLTFREQLTT ITEHSPRDIS       120
     GWHICLKKLQ ASAEGKIYDF NKTEFETLFA KYQKELNIEK                             160
//

If you have problems or comments...

PBIL Back to PBIL home page