(data stored in ACNUC10821 zone)

EMBL: AE017262.PE415

AE017262.PE415       Location/Qualifiers
FT   CDS             436683..439316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0421"
FT                   /product="glycosyl hydrolase, family 38"
FT                   /note="identified by match to protein family HMM PF01074;
FT                   match to protein family HMM PF07748"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0421"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03205"
FT                   /protein_id="AAT03205.1"
FT                   /translation="MKMAKTKVHVIPHSHWDREWYFTSSRSTIYLVKHLKEVIETLEAK
FT                   DDYHFYLMDAQSSLIEDYLHYCPEDKTRLEKLIAEKRLITGPWYTQTDQLVISQESIVR
FT                   NLLYGTRIAREMGHSMAVGYVPDAFGQGGNMPQIYKEFGISKFLFWRGVADNRLKQTEF
FT                   IWRGDDGTEMLAEQIPFGYYYGANIPENEAELKTYLDDQIGALEEKASTRNVYFPNGLD
FT                   QAPVRENLPELVAKFNELDSTREYQIASPETFFADLEKDVTNLPVIAGELTEGKHSRLH
FT                   KSIFSTRADLKQANNEIENFLSNVLEPVLSISYSLGNRYPHNELAEIWKLMFENAAHDS
FT                   IGGCNSDTTNRDVKHRYKLASDLATNLLDLNMRLISEKIEQKQPFQFTVFNPLPYEKSG
FT                   VIKMTAYIPEDNFEIEDTQGNTLEYTILEKTDLTDYVLNQHIDLNPSKSIYLPEKVFLA
FT                   TMLVNVNSLPALGYDTIYFNLEKETAEQEPTQSTMTKIENEFYEIQLAANNSLTIHDKK
FT                   AGRTYTDQMLFVENGDDGDSYNYSPPRKDLVISSEEAVVESLESSISSVNQTLTISFKL
FT                   NVPYNLEERANGEKSNEMTIKTVISLRKNEELIRFDVQVANQVLSHRLCVTFATEIASK
FT                   FSTADQLFAPIQRPVRLPEMDVWEAEEWQEAPISIEAMQSFVSLHDEAHGVAVMTEGVR
FT                   EYEIIGENYDTISLTLFRTFSHMGKTDLLYRPGRASGESIVATPDAQLLGEINATFALT
FT                   LFESSFDEADIAKKAKEYLSNPPVYQMSDFLNGRLIYVYRDEEKTLDATYSLALPTIDG
FT                   AIISAVKKAEDADAFITRFFNPYLQKEITIPEVFRGKERHLDESESNEKQTRLKHAKVQ
FT                   SYLFEK"
     MKMAKTKVHV IPHSHWDREW YFTSSRSTIY LVKHLKEVIE TLEAKDDYHF YLMDAQSSLI        60
     EDYLHYCPED KTRLEKLIAE KRLITGPWYT QTDQLVISQE SIVRNLLYGT RIAREMGHSM       120
     AVGYVPDAFG QGGNMPQIYK EFGISKFLFW RGVADNRLKQ TEFIWRGDDG TEMLAEQIPF       180
     GYYYGANIPE NEAELKTYLD DQIGALEEKA STRNVYFPNG LDQAPVRENL PELVAKFNEL       240
     DSTREYQIAS PETFFADLEK DVTNLPVIAG ELTEGKHSRL HKSIFSTRAD LKQANNEIEN       300
     FLSNVLEPVL SISYSLGNRY PHNELAEIWK LMFENAAHDS IGGCNSDTTN RDVKHRYKLA       360
     SDLATNLLDL NMRLISEKIE QKQPFQFTVF NPLPYEKSGV IKMTAYIPED NFEIEDTQGN       420
     TLEYTILEKT DLTDYVLNQH IDLNPSKSIY LPEKVFLATM LVNVNSLPAL GYDTIYFNLE       480
     KETAEQEPTQ STMTKIENEF YEIQLAANNS LTIHDKKAGR TYTDQMLFVE NGDDGDSYNY       540
     SPPRKDLVIS SEEAVVESLE SSISSVNQTL TISFKLNVPY NLEERANGEK SNEMTIKTVI       600
     SLRKNEELIR FDVQVANQVL SHRLCVTFAT EIASKFSTAD QLFAPIQRPV RLPEMDVWEA       660
     EEWQEAPISI EAMQSFVSLH DEAHGVAVMT EGVREYEIIG ENYDTISLTL FRTFSHMGKT       720
     DLLYRPGRAS GESIVATPDA QLLGEINATF ALTLFESSFD EADIAKKAKE YLSNPPVYQM       780
     SDFLNGRLIY VYRDEEKTLD ATYSLALPTI DGAIISAVKK AEDADAFITR FFNPYLQKEI       840
     TIPEVFRGKE RHLDESESNE KQTRLKHAKV QSYLFEK                                877
//

If you have problems or comments...

PBIL Back to PBIL home page