(data stored in ACNUC10821 zone)

EMBL: AE017262.PE418

AE017262.PE418       Location/Qualifiers
FT   CDS             441823..442215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0424"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0424"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03208"
FT                   /protein_id="AAT03208.1"
FT                   /translation="MITFLPIFFIFAIFLGLAAKVLLAIWIYKDAEQRGMNAILWCLLM
FT                   VFINVIIILVIYLIVRNKGEVMKQNLGLLISGIGIAVLNTLMAIMAFIFIIFFAVNDGG
FT                   MHNMMDGYNYDYDDGYEYDMDNFEDF"
     MITFLPIFFI FAIFLGLAAK VLLAIWIYKD AEQRGMNAIL WCLLMVFINV IIILVIYLIV        60
     RNKGEVMKQN LGLLISGIGI AVLNTLMAIM AFIFIIFFAV NDGGMHNMMD GYNYDYDDGY       120
     EYDMDNFEDF                                                              130
//

If you have problems or comments...

PBIL Back to PBIL home page